Anti-GFPT2

Code: SAB2104864-100UL D2-231

Biochem/physiol Actions

GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and ...


read more

Your Price
£459.00 100UL
Discontinued
£550.80 inc. VAT

Biochem/physiol Actions

GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human GFPT2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GFPT2(9945)
mol wt77 kDa
NCBI accession no.NM_005110
Quality Level100
shipped inwet ice
species reactivityguinea pig, rat, human, bovine, horse, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.O94808
This product has met the following criteria to qualify for the following awards: