ANTI-SLC25A32

Code: SAB2108579-100UL D2-231

Biochem/physiol Actions

SLC25A32 transports folate across the inner membranes of mitochondria.

Disclaimer

Unless otherwise stated in our catalog ...


read more

Your Price
£437.00 100UL
£524.40 inc. VAT

Biochem/physiol Actions

SLC25A32 transports folate across the inner membranes of mitochondria.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human SLC25A32

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT

accession no.NM_030780
antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5-1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... SLC25A32(81034)
mol wt35 kDa
Quality Level100
shipped inwet ice
species reactivityguinea pig, human, horse, dog, bovine, rat, mouse, rabbit
storage temp.−20°C
technique(s)immunoblotting: suitable
UniProt accession no.Q9H2D1
This product has met the following criteria: