Application

Immunoblotting (4 µg/ml, chemiluminescence)r>Immunocytochemistry (1:1000)r>Immunoprecipitation (20 µg/ml)

General description

Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.

Recognizes the ~32 kDa HO-1 protein.

Immunogen

a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Human

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Other Notes

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.

Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.Maines, M.D. 1988. FASEB J.2, 2557.Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Packaging

200 µg in Plastic ampoule

Please refer to vial label for lot-specific concentration.

Physical form

In PBS, 50% glycerol.

Reconstitution

Following initial thaw, aliquot and freeze (-20°C).

Warning

Toxicity: Standard Handling (A)