Application

Anti-KLF11 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 µg/ml.

Biochem/physiol Actions

KLF11 belongs to KLF family of transcription factors that regulate GC promoters and important metabolic processes in diverse organisms. The histone acetyltransferase pathways mediated by KLF11 affect the regulation of insulin in neonatal diabetes. KLF11 mediates increase in basal insulin levels and glucose-stimulated insulin secretion. It suppresses inflammatory activation of endothelial cells by inhibition of NF-κB pathway that results in downregulation of VCAM-1 and E-selectin promoters.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human KLF11

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ