Application
Rabbit Anti-HPRT1 antibody has been used for western blot applications.
Biochem/physiol Actions
HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate (Keebaugh et al., 2007 [PubMed 16928426]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description
Hypoxanthine phosphoribosyltransferase 1 (HPRT1) is known to catalyze the transfer of 5-phosphoribosyl group, thereby converting hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate during purine nucleotide synthesis. HPRT1-ALDH16A1 interactions have been linked to the pathophysiology of gout. HPRT1 mutation has been associated with Lesch-Nyhan disease.Rabbit Anti-HPRT1 antibody recognizes zebrafish, bovine, canine, human, mouse, rat, pig, chicken, and rabbit HPRT1.
Immunogen
Synthetic peptide directed towards the middle region of human HPRT1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK
This product has met the following criteria to qualify for the following awards: