Anti-JPH3

Code: av49534-100ul D2-231

Application

Anti-JPH3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

J...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Application

Anti-JPH3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0µg/ml.

Biochem/physiol Actions

Junctophilins are localized to the endoplasmic/sarcoplasmic reticulum membrane and anchor it to the plasma membrane. Mutations in Junctophilin 3 (JPH3) induces polyglutamine protein toxicity in Huntington′s disease.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the N terminal region of human JPH3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... JPH3(57338)
mol wt81 kDa
NCBI accession no.NP_065706
Quality Level100
shipped inwet ice
species reactivitypig, rat, bovine, mouse, horse, human, dog
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q8WXH2
This product has met the following criteria: