Biochem/physiol Actions
EPAS1 is a transcription factor involved in the induction of oxygen regulated genes. EPAS1 binds to core DNA sequence 5′-[AG]CGTG-3′ within the hypoxia response element (HRE) of target gene promoters. EPAS1 regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. EPAS1 may also play a role in the formation of the endothelium that gives rise to the blood brain barrier. EPAS1 is a potent activator of the Tie-2 tyrosine kinase expression. The activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction of EPAS1 with redox regulatory protein APEX seems to activate CTAD.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen
Synthetic peptide directed towards the middle region of human EPAS1
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD
This product has met the following criteria to qualify for the following awards: