Anti-GNB4

Code: sab2106131-100ul D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


read more

Your Price
£437.00 100UL
£524.40 inc. VAT

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human GNB4

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GNB4(59345)
mol wt37 kDa
NCBI accession no.NM_021629
Quality Level100
shipped inwet ice
species reactivitybovine, horse, dog, rat, human, guinea pig, rabbit
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9HAV0
This product has met the following criteria: