Anti-GTF2H3

Code: av31438-100ul D2-231

Application

Rabbit Anti-GTF2H3 antibody can be used for western blot (2µg/ml) and immunohistochemistry (4-8µg/ml) assays.

Biochem/physiol Actions

read more

Your Price
£437.00 100UL
£524.40 inc. VAT

Application

Rabbit Anti-GTF2H3 antibody can be used for western blot (2µg/ml) and immunohistochemistry (4-8µg/ml) assays.

Biochem/physiol Actions

GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

GTF2H3 belongs to the TFB4 family of transcription factors and forms a part of the TFIIH complex. GTF2H3 regulates nucleotide excision repair and RNA polymerase II-mediated transcription. Rabbit Anti-GTF2H3 antibody recognizes bovine, human, mouse, and rat GTF2H3.

Immunogen

Synthetic peptide directed towards the N terminal region of human GTF2H3

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... GTF2H3(2967)
mol wt34 kDa
NCBI accession no.NP_001507
Quality Level100
shipped inwet ice
species reactivitypig, human, mouse, rat, rabbit, horse
storage temp.−20°C
technique(s)western blot: suitable, immunohistochemistry: suitable
UniProt accession no.Q13889
This product has met the following criteria: