Anti-CNOT2

Code: av32048-100ul D2-231

Application

Rabbit Anti-CNOT2 antibody can be used for western blot applications at a concentration of 1.25µg/ml.

Biochem/physiol Actions

CN...


read more

Your Price
£384.00 100UL
£460.80 inc. VAT

Application

Rabbit Anti-CNOT2 antibody can be used for western blot applications at a concentration of 1.25µg/ml.

Biochem/physiol Actions

CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

CNOT2 forms a part of the transcriptional regulator, the Ccr4-Not complex, and can repress promoter functions. Studies have reported that depletion of CNOT2 inhibits CCR4-NOT deadenylase and causes apoptosis in cells. Furthermore, the SMRT/NCoR-HDAC3 complex is known to be a cofactor of CNOT2-mediated transcriptional repression.Rabbit Anti-CNOT2 antibody recognizes bovine, human, mouse, rat, canine, and chicken CNOT2.

Immunogen

Synthetic peptide directed towards the middle region of human CNOT2

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ

antibody formIgG fraction of antiserum
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... CNOT2(4848)
mol wt40 kDa
NCBI accession no.NP_055330
Quality Level100
shipped inwet ice
species reactivityhuman, bovine, rabbit, horse, guinea pig, rat, dog, mouse
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q9NZN8-2
This product has met the following criteria: