Anti-C9ORF117

Code: av54415-100ul D2-231

Application

Anti-C9ORF117 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Disclaimer

Unless other...


read more

Your Price
£478.00 100UL
£573.60 inc. VAT

Application

Anti-C9ORF117 antibody produced in rabbit is suitable for western blotting at a concentration of 1µg/mL.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

C9ORF117 (chromosome 9 open reading frame 117) gene encodes a protein located on to 9q34.11. It is a target gene for hsa-miR-151a-3p and was used to examine the association of human diseases with the predicted target genes. Expression of C9ORF117 gene was used to study the mechanisms of respiratory sensitization.

Immunogen

Synthetic peptide directed towards the N terminal region of human C9orf117

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Sequence

Synthetic peptide located within the following region: LAKEMEKDAFEAQLAQVRHEFQETKDQLTTENIILGGKLAALEEFRLQKE

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg - 1 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... C9orf117(286207)
mol wt60 kDa
NCBI accession no.NP_001012520
Quality Level100
shipped inwet ice
species reactivityrat, human, horse, dog, bovine, guinea pig
storage temp.−20°C
technique(s)western blot: suitable
UniProt accession no.Q5JU67
This product has met the following criteria: